PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10011014m
Common NameCARUB_v10011014mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 258aa    MW: 29727.6 Da    PI: 7.0194
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10011014mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.92e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +l+ ++++lG  +W++ +r+ g++R++k+c++rw++yl
  Carubv10011014m 14 KGEWTAEEDRRLIAYINELGITDWRSLPRRAGLNRCGKSCRLRWLNYL 61
                     799*******************************************97 PP

2Myb_DNA-binding56.37.1e-1867111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T++Ede +++ ++ lG++ W++Ia+ m+ +Rt++++k++w++ 
  Carubv10011014m  67 RGKFTPQEDEAIIKFHAFLGNR-WAAIAQLMQ-NRTDNDIKNHWNSC 111
                      89********************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.426961IPR017930Myb domain
SuperFamilySSF466893.71E-2911108IPR009057Homeodomain-like
SMARTSM007174.8E-141363IPR001005SANT/Myb domain
PfamPF002495.6E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-221568IPR009057Homeodomain-like
CDDcd001671.22E-91661No hitNo description
PROSITE profilePS5129425.64662116IPR017930Myb domain
SMARTSM007172.8E-1566114IPR001005SANT/Myb domain
PfamPF002493.1E-1667111IPR001005SANT/Myb domain
CDDcd001671.45E-969109No hitNo description
Gene3DG3DSA:1.10.10.607.6E-2569116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MGRKTWFDVA GMKKGEWTAE EDRRLIAYIN ELGITDWRSL PRRAGLNRCG KSCRLRWLNY  60
LRPGIRRGKF TPQEDEAIIK FHAFLGNRWA AIAQLMQNRT DNDIKNHWNS CLKKRLERNG  120
INPMTHEPII KHLTVKTNKE DFGSTSTTTS SSMESSPSSG SARILNKLAA GISSRQHSLD  180
RIKYILSNPI IISSDQVEEG RELDMDHKID GGEEEDDIQI WDEEEVRRLM GIHVMDYEMT  240
SYDSVMYEST HILDHLF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-2691172109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006303555.10.0hypothetical protein CARUB_v10011014mg
TrEMBLR0IHV40.0R0IHV4_9BRAS; Uncharacterized protein
STRINGfgenesh1_pg.C_scaffold_10016911e-136(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18710.11e-118myb domain protein 47